PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000248942
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GATA
Protein Properties Length: 627aa    MW: 72000.8 Da    PI: 11.2126
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000248942genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA53.14.3e-17310343134
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                    C +C  tkTp+WR gp g+ktLCnaCG++y++ +
  MDP0000248942 310 CLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 343
                    99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.424304340IPR000679Zinc finger, GATA-type
SMARTSM004019.3E-17304354IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.28E-14308367No hitNo description
Gene3DG3DSA:3.30.50.103.6E-14308341IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.25E-12309356No hitNo description
PROSITE patternPS003440310335IPR000679Zinc finger, GATA-type
PfamPF003209.2E-15310343IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 627 aa     Download sequence    Send to blast
MAVFCLVARK TRENAQFPPV LTTICDGEND RTELYRRYRL REPLRHHRRP PRFPNRRRRV  60
RPRPRPQLRR RLQLLLPLAR PFRLAPASQR RRLLLQLRLR PLRRARRSGE SHSPSSPRFL  120
SRCLRGIYQC RFHGISIEDI VQLEWLSNFC EDSFSGGSLT INKPDISFIN REPSHQQFQT  180
SSPISVLDSS SSCSVEKNVP QSPGAVVPGK RGRARSKRPR PATFNPRSAI QLISPASSVT  240
EAEALQHQQL LPPKVHSDSE NFAESRPVIK IPRQASGEQK KKKKIKLTLP QAPAEGNQSS  300
GTTQGAVRKC LHCEITKTPQ WRAGPMGPKT LCNACGVRYK SGRLFPEYRP AASPTFVPAL  360
HSNSHKKVIE MRNKGGEVVP FGETTTAMTE TPELIPNTNH SISLDYISFV VDKILKRVLE  420
FEICIASYRF LLLLFSVLRP SGVPNFLPFR LKHSNFATRF GLKKKEGLII NDGNWLLLLL  480
FQSIFLAHLS NHFLLLPQLK LARWSSIIIH QQLIRTICAI ICTYLLDFLP FSKSIREKHM  540
ALFDTDAMTQ IREKTHPRVY PFYLSLLYCS PHVLYKLSHK RLYTSLNSDT RTKISPTTGC  600
KRYYLRHSPQ VRQKKRVYIP FQTNYSA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15670RRRVRPRPRPQLRRR
2216220KRPRP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.50970.0bud| cell culture| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48873356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.22e-40GATA family protein